ये वाला पनीर बनाने से मेरा काम आसान😄हो गया और सब ऊंगली चाट-चाट कर खाते है,वो भी बिना प्याज-लहसुन के😉

#Justaddmagicwithsheetal  #paneerrecipe #paneeryakhni #kashmiripaneeryakhni #justaddmagicwithsheetal Today I am sharing with you a very tasty and different tasting paneer recipe without onion-garlic and very less spices and oil. Hope you like the recipe and video. if you enjoyed watching this video & want to see more such videos than please 🙏 👇👇👇👇👇👇 DON'T forget to like and subscribe my channel  And Share my video with your family and friends Thank you for watching & support my channel😊🙏 आज मैं आपके साथ बिना प्याज-लहसुन और बहुत कम मसाले और तेल के बहुत ही स्वादिष्ट और अलग स्वाद वाली पनीर रेसिपी शेयर कर रही हूं। उम्मीद है आपको रेसीपी और विडियो पसंद आएगा । अगर आपको यह वीडियो देखने में अच्छा लगा और आप ऐसे और भी वीडियो देखना चाहते हैं तो कृपया 🙏 👇👇👇👇👇👇 मेरे चैनल को लाइक और सब्सक्राइब करना न भूलें और मेरे वीडियो को अपने परिवार और दोस्तों के साथ साझा करें मेरे चैनल को देखने और समर्थन करने के  लिए धन्यवाद 🙏😊 Paneeryakhnirecipe,kashmiripaneeryakhni,howtomakepaneerwithoutoniongarlic,paneeryakhnistepbysteptutorial,vegetarianpaneeryakhni, My other recipe video link👇👇👇 👇👇👇👇👇👇👇👇👇👇👇👇 Mera paag, Janmashtami special    • 🎉खूब ज़ोरो शोरो से हो रही है कन्हा 🎉🎉🤗...   No bread sandwich    • घर पर ज्यादा सामान न हो और अचानक मेहम...   Vermicelli rabri katori    • इसके बिना राखी का त्यौहार अधूरा हैं🤗|...   Dry Fruit Madhuram|इस बार जन्माष्टमी पर ये मिठाई बना ली तो ठाकुर जी को खुद दर्शन देंगें    • मूंगफली की ये स्वादिष्ठ बर्फी आपने बन...   गेंहू के आटे से बना ये नाश्ता आपकी चाय का स्वाद बढा देगा    • Whole Wheat teatime snack|गेंहू के आट...   न मावा, न  काजू ,न मैदा,न चाॅकलेट,10 मिनट मे तैयार बिना घंटो मेहनत के Chocolate barfi    • इस राखी बनाईये सिर्फ 10 मिनट मे ये चॉ...   Kesari Rajbhog recipe    • मीठा खाने के शौकीन हैं तो इस राखी पर ...   आपके टेस्ट बडस खोल देंगे ये सोयाबीन कबाब रोल    • आपके सारे taste buds खोल देंगे ऐसे बि...   peanut barfi वो भी40 रुपए मे आधा किलो    • सिर्फ40रुपये मे ये आधा किलो बर्फी तैय...   Mathura special malai Ghewar    • राखी पर ये मिठाई ना बनाऊं हो ही नही स...   Corn chaat, mall style different flavours    • कभी सोचा नही होगा कि भुट्टे 🌽को इतना ...   High protein dinner wraps    • High protein😋dinner🌯wraps with protei...   pavbhaji bites    • रोज एक ही तरह का नाश्ता खाकर बोर हो ग...   moradabadi dal    • ये मूँगदाल नाश्ता-ढोकला,चीला,मंगौडे-प...   Youtube channel @Justaddmagic18  Facebook Instagram www.instagram.com/just_add_magic_with_sheetal_?igs…

• #people_blogs
• #paneeryakhni
• #kashmiripaneeryakhni
• #paneerinyogurtgravy
• #vegetarianyakhnirecipewithpaneer
• #yakhnipaneerstepbysteptutorial
• #nooniongarlicpaneerrecipe
• #kashmiricuisinepaneeryakhni
• #justaddmagicwithsheetal
• #yakhnipaneerrecipebysheetal
• #cookingvideo
• #paneerrecipe